MED8 Antikörper (N-Term)

Produktnummer ABIN632351

This anti-MED8 antibody (ABIN632351) is a Rabbit Polyclonal antibody detecting MED8 in WB. Suitable for Human, Mouse.

Kurzübersicht für MED8 Antikörper (N-Term) (ABIN632351)

Target: MED8 (Mediator Complex Subunit 8 (MED8))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MED8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MED8 Antikörper

Bindungsspezifität: N-Term

Spezifität: MED8 antibody was raised against the N terminal of MED8

Aufreinigung: Affinity purified

Immunogen: MED8 antibody was raised using the N terminal of MED8 corresponding to a region with amino acids MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MED8 Blocking Peptide, catalog no. 33R-6339, is also available for use as a blocking control in assays to test for specificity of this MED8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MED8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MED8

Target: MED8 (Mediator Complex Subunit 8 (MED8))

Andere Bezeichnung: MED8

Hintergrund: MED8 is a protein that is one of more than 20 subunits of the mediator complex, first identified in S. cerevisiae, that is required for activation of transcription. MED8 also interacts with elongins B and C, and CUL2 and RBX1, to reconstitute a ubiquitin ligase.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha