RWDD2A Antikörper (N-Term)

Produktnummer ABIN632350

Produktdetails anti-RWDD2A Antikörper

Target: RWDD2A (RWD Domain Containing 2A (RWDD2A))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RWDD2A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RWDD2 A antibody was raised against the N terminal of RWDD2

Aufreinigung: Affinity purified

Immunogen: RWDD2 A antibody was raised using the N terminal of RWDD2 corresponding to a region with amino acids NALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKIDLQVTMPHSYPYVA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RWDD2A Blocking Peptide, catalog no. 33R-6639, is also available for use as a blocking control in assays to test for specificity of this RWDD2A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RWDD0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RWDD2A

Target: RWDD2A (RWD Domain Containing 2A (RWDD2A))

Andere Bezeichnung: RWDD2A (RWDD2A Produkte)

Synonyme: RWDD2 antikoerper, dJ747H23.2 antikoerper, 1700030C20Rik antikoerper, AI848608 antikoerper, Rwdd2 antikoerper, RWD domain containing 2A antikoerper, RWDD2A antikoerper, Rwdd2a antikoerper

Hintergrund: The specific function of RWDD2A is not yet known.

Molekulargewicht: 32 kDa (MW of target protein)