MTHFS Antikörper

Produktnummer ABIN632349

Produktdetails anti-MTHFS Antikörper

Target: MTHFS (5,10-Methenyltetrahydrofolate Synthetase (5-Formyltetrahydrofolate Cyclo-Ligase) (MTHFS))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTHFS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: MTHFS antibody was raised using a synthetic peptide corresponding to a region with amino acids TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MTHFS Blocking Peptide, catalog no. 33R-9306, is also available for use as a blocking control in assays to test for specificity of this MTHFS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTHFS

Target: MTHFS (5,10-Methenyltetrahydrofolate Synthetase (5-Formyltetrahydrofolate Cyclo-Ligase) (MTHFS))

Andere Bezeichnung: MTHFS (MTHFS Produkte)

Synonyme: MTHFS antikoerper, 1110034I12Rik antikoerper, 2310020H23Rik antikoerper, AI119695 antikoerper, HsT19268 antikoerper, 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase) antikoerper, methenyltetrahydrofolate synthetase antikoerper, 5-formyltetrahydrofolate cyclo-ligase (predicted) antikoerper, 5-formyltetrahydrofolate cyclo-ligase antikoerper, 5, 10-methenyltetrahydrofolate synthetase antikoerper, MTHFS antikoerper, SPBC1703.08c antikoerper, ZMO0215 antikoerper, LBA1507 antikoerper, Rxyl_1321 antikoerper, MEMAR_RS07640 antikoerper, Mjls_4669 antikoerper, STROP_RS03755 antikoerper, Mext_0779 antikoerper, AMF_RS07350 antikoerper, CKC_02040 antikoerper, Mthfs antikoerper

Hintergrund: MTHFS contributes to tetrahydrofolate metabolism. It helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids.

Molekulargewicht: 23 kDa (MW of target protein)