KLHDC8B Antikörper (Middle Region)
-
- Target Alle KLHDC8B Antikörper anzeigen
- KLHDC8B (Kelch Domain Containing 8B (KLHDC8B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KLHDC8B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KLHDC8 B antibody was raised against the middle region of KLHDC8
- Aufreinigung
- Affinity purified
- Immunogen
- KLHDC8 B antibody was raised using the middle region of KLHDC8 corresponding to a region with amino acids AMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSLRM
- Top Product
- Discover our top product KLHDC8B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KLHDC8B Blocking Peptide, catalog no. 33R-1383, is also available for use as a blocking control in assays to test for specificity of this KLHDC8B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLHDC8B (Kelch Domain Containing 8B (KLHDC8B))
- Andere Bezeichnung
- KLHDC8B (KLHDC8B Produkte)
- Synonyme
- DKFZp468J2023 antikoerper, 4931406O17Rik antikoerper, kelch domain containing 8B antikoerper, KLHDC8B antikoerper, Klhdc8b antikoerper
- Hintergrund
- KLHDC8B contains 8 Kelch repeats. The exact function of KLHDC8B remains unknown.
- Molekulargewicht
- 38 kDa (MW of target protein)
-