KLHDC8B Antikörper (Middle Region)

Produktnummer ABIN632348

Der Kaninchen Polyklonal Anti-KLHDC8B-Antikörper wurde für WB validiert. Er ist geeignet, KLHDC8B in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für KLHDC8B Antikörper (Middle Region) (ABIN632348)

Target: KLHDC8B (Kelch Domain Containing 8B (KLHDC8B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KLHDC8B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KLHDC8B Antikörper

Bindungsspezifität: Middle Region

Spezifität: KLHDC8 B antibody was raised against the middle region of KLHDC8

Aufreinigung: Affinity purified

Immunogen: KLHDC8 B antibody was raised using the middle region of KLHDC8 corresponding to a region with amino acids AMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSLRM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLHDC8B Blocking Peptide, (ABIN936769), is also available for use as a blocking control in assays to test for specificity of this KLHDC8B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KLHDC8B

Target: KLHDC8B (Kelch Domain Containing 8B (KLHDC8B))

Andere Bezeichnung: KLHDC8B

Hintergrund: KLHDC8B contains 8 Kelch repeats. The exact function of KLHDC8B remains unknown.

Molekulargewicht: 38 kDa (MW of target protein)