NDRG2 Antikörper (C-Term)
-
- Target Alle NDRG2 Antikörper anzeigen
- NDRG2 (NDRG Family Member 2 (NDRG2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NDRG2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NDRG2 antibody was raised against the C terminal of NDRG2
- Aufreinigung
- Affinity purified
- Immunogen
- NDRG2 antibody was raised using the C terminal of NDRG2 corresponding to a region with amino acids GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG
- Top Product
- Discover our top product NDRG2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NDRG2 Blocking Peptide, catalog no. 33R-3680, is also available for use as a blocking control in assays to test for specificity of this NDRG2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDRG2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NDRG2 (NDRG Family Member 2 (NDRG2))
- Andere Bezeichnung
- NDRG2 (NDRG2 Produkte)
- Synonyme
- NDRG2 antikoerper, AI182517 antikoerper, AU040374 antikoerper, Ndr2 antikoerper, SYLD antikoerper, im:6909381 antikoerper, si:dkey-88n24.1 antikoerper, zgc:101847 antikoerper, NDRG family member 2 antikoerper, N-myc downstream regulated gene 2 antikoerper, NDRG family member 2 S homeolog antikoerper, ndrg2 antikoerper, NDRG2 antikoerper, Ndrg2 antikoerper, ndrg2.S antikoerper
- Hintergrund
- The NDRG2 gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. NDRG2 is a cytoplasmic protein that may play a role in neurite outgrowth. Its gene may be involved in glioblastoma carcinogenesis.
- Molekulargewicht
- 39 kDa (MW of target protein)
-