NDRG2 Antikörper (C-Term)
Kurzübersicht für NDRG2 Antikörper (C-Term) (ABIN632346)
Target
Alle NDRG2 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- C-Term
-
Spezifität
- NDRG2 antibody was raised against the C terminal of NDRG2
-
Aufreinigung
- Affinity purified
-
Immunogen
- NDRG2 antibody was raised using the C terminal of NDRG2 corresponding to a region with amino acids GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG
-
-
-
-
Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
NDRG2 Blocking Peptide, (ABIN939066), is also available for use as a blocking control in assays to test for specificity of this NDRG2 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDRG2 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- NDRG2 (NDRG Family Member 2 (NDRG2))
-
Andere Bezeichnung
- NDRG2
-
Hintergrund
- The NDRG2 gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. NDRG2 is a cytoplasmic protein that may play a role in neurite outgrowth. Its gene may be involved in glioblastoma carcinogenesis.
-
Molekulargewicht
- 39 kDa (MW of target protein)
Target
-