NDRG2 Antikörper (C-Term)

Produktnummer ABIN632346

Dieses Anti-NDRG2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von NDRG2 in WB. Geeignet für Human, Ratte und Maus.

Kurzübersicht für NDRG2 Antikörper (C-Term) (ABIN632346)

Target: NDRG2 (NDRG Family Member 2 (NDRG2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NDRG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NDRG2 Antikörper

Bindungsspezifität: C-Term

Spezifität: NDRG2 antibody was raised against the C terminal of NDRG2

Aufreinigung: Affinity purified

Immunogen: NDRG2 antibody was raised using the C terminal of NDRG2 corresponding to a region with amino acids GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NDRG2 Blocking Peptide, (ABIN939066), is also available for use as a blocking control in assays to test for specificity of this NDRG2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDRG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NDRG2

Target: NDRG2 (NDRG Family Member 2 (NDRG2))

Andere Bezeichnung: NDRG2

Hintergrund: The NDRG2 gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. NDRG2 is a cytoplasmic protein that may play a role in neurite outgrowth. Its gene may be involved in glioblastoma carcinogenesis.

Molekulargewicht: 39 kDa (MW of target protein)