BCL7A Antikörper (Middle Region)

Produktnummer ABIN632344

Produktdetails anti-BCL7A Antikörper

Target: BCL7A (B-Cell CLL/lymphoma 7A (BCL7A))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BCL7A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BCL7 A antibody was raised against the middle region of BCL7

Aufreinigung: Affinity purified

Immunogen: BCL7 A antibody was raised using the middle region of BCL7 corresponding to a region with amino acids CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BCL7A Blocking Peptide, catalog no. 33R-1704, is also available for use as a blocking control in assays to test for specificity of this BCL7A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BCL7A

Target: BCL7A (B-Cell CLL/lymphoma 7A (BCL7A))

Andere Bezeichnung: BCL7A (BCL7A Produkte)

Synonyme: BCL7 antikoerper, cb585 antikoerper, id:ibd1097 antikoerper, sb:cb585 antikoerper, wu:fk02d01 antikoerper, zgc:92023 antikoerper, 4432415N06Rik antikoerper, AI448316 antikoerper, bcl7a antikoerper, MGC89576 antikoerper, BCL7A antikoerper, BCL tumor suppressor 7A antikoerper, B-cell CLL/lymphoma 7A antikoerper, B cell CLL/lymphoma 7A antikoerper, B-cell CLL/lymphoma 7A L homeolog antikoerper, BCL7A antikoerper, bcl7a antikoerper, Bcl7a antikoerper, bcl7a.L antikoerper

Hintergrund: This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 25 kDa (MW of target protein)