BCL7A Antikörper (Middle Region)
-
- Target Alle BCL7A Antikörper anzeigen
- BCL7A (B-Cell CLL/lymphoma 7A (BCL7A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BCL7A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BCL7 A antibody was raised against the middle region of BCL7
- Aufreinigung
- Affinity purified
- Immunogen
- BCL7 A antibody was raised using the middle region of BCL7 corresponding to a region with amino acids CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN
- Top Product
- Discover our top product BCL7A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BCL7A Blocking Peptide, catalog no. 33R-1704, is also available for use as a blocking control in assays to test for specificity of this BCL7A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCL0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BCL7A (B-Cell CLL/lymphoma 7A (BCL7A))
- Andere Bezeichnung
- BCL7A (BCL7A Produkte)
- Hintergrund
- This gene is directly involved, with Myc and IgH, in a three-way gene translocation in a Burkitt lymphoma cell line. As a result of the gene translocation, the N-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade B cell non-Hodgkin lymphoma. The N-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of BCL7B and BCL7C. Two transcript variants encoding different isoforms have been found for this gene.
- Molekulargewicht
- 25 kDa (MW of target protein)
-