SYDE1 Antikörper

Produktnummer ABIN632336

Der Kaninchen Polyklonal Anti-SYDE1 Antikörper wurde für WB validiert. Er ist geeignet, SYDE1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für SYDE1 Antikörper (ABIN632336)

Target: SYDE1 (Synapse Defective 1, rho GTPase, Homolog 1 (SYDE1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SYDE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SYDE1 Antikörper

Aufreinigung: Affinity purified

Immunogen: SYDE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PYLRPKRQPPLHLPLADPEVVTRPRGRGGPESPPSNRYAGDWSVCGRDFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SYDE1 Blocking Peptide, (ABIN5616467), is also available for use as a blocking control in assays to test for specificity of this SYDE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYDE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SYDE1

Target: SYDE1 (Synapse Defective 1, rho GTPase, Homolog 1 (SYDE1))

Andere Bezeichnung: SYDE1

Hintergrund: SYDE1 contains 1 Rho-GAP domain. It is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Molekulargewicht: 80 kDa (MW of target protein)