serine Dehydratase Antikörper (Middle Region)

Produktnummer ABIN632335

Produktdetails anti-serine Dehydratase Antikörper

Target: serine Dehydratase (SDS)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser serine Dehydratase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SDS antibody was raised against the middle region of SDS

Aufreinigung: Affinity purified

Immunogen: SDS antibody was raised using the middle region of SDS corresponding to a region with amino acids KITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SDS Blocking Peptide, catalog no. 33R-4446, is also available for use as a blocking control in assays to test for specificity of this SDS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu serine Dehydratase

Target: serine Dehydratase (SDS)

Andere Bezeichnung: SDS (SDS Produkte)

Synonyme: SDH antikoerper, RATSDHE1 antikoerper, SDH2 antikoerper, Sdh antikoerper, Sdhe1 antikoerper, TDH antikoerper, 4432411H13Rik antikoerper, sdh antikoerper, serine dehydratase antikoerper, serine dehydratase S homeolog antikoerper, SDS antikoerper, Sds antikoerper, sds.S antikoerper, sds antikoerper

Hintergrund: This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor.

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly