C1ORF74 Antikörper (N-Term)

Produktnummer ABIN632333

Produktdetails anti-C1ORF74 Antikörper

Target: C1ORF74 (Chromosome 1 Open Reading Frame 74 (C1ORF74))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C1ORF74 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C1 ORF74 antibody was raised against the N terminal Of C1 rf74

Aufreinigung: Affinity purified

Immunogen: C1 ORF74 antibody was raised using the N terminal Of C1 rf74 corresponding to a region with amino acids ICLHLAGEVLAVARGLKPAVLYDCNCAGASELQSYLEELKGLGFLTFGLH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF74 Blocking Peptide, catalog no. 33R-3903, is also available for use as a blocking control in assays to test for specificity of this C1ORF74 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF74 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C1ORF74

Target: C1ORF74 (Chromosome 1 Open Reading Frame 74 (C1ORF74))

Andere Bezeichnung: C1ORF74 (C1ORF74 Produkte)

Synonyme: C1orf74 antikoerper, DKFZp469F2128 antikoerper, chromosome 1 open reading frame 74 antikoerper, chromosome 1 open reading frame 74 L homeolog antikoerper, chromosome 26 C1orf74 homolog antikoerper, hypothetical protein LOC100125367 antikoerper, chromosome 1 open reading frame, human C1orf74 antikoerper, RIKEN cDNA A130010J15 gene antikoerper, chromosome ssa22 open reading frame, human C1orf74 antikoerper, chromosome 16 open reading frame, human C1orf74 antikoerper, zgc:112163 antikoerper, C1orf74 antikoerper, c1orf74.L antikoerper, c1orf74 antikoerper, C26H1orf74 antikoerper, LOC100125367 antikoerper, C1H1orf74 antikoerper, A130010J15Rik antikoerper, cssa22h1orf74 antikoerper, C16H1orf74 antikoerper, zgc:112163 antikoerper

Hintergrund: The specific function of C1orf74 is not yet known.

Molekulargewicht: 29 kDa (MW of target protein)