CCDC78 Antikörper (Middle Region)

Produktnummer ABIN632324

Der Kaninchen Polyklonal Anti-CCDC78-Antikörper wurde für WB validiert. Er ist geeignet, CCDC78 in Proben von Human zu detektieren.

Kurzübersicht für CCDC78 Antikörper (Middle Region) (ABIN632324)

Target: CCDC78 (Coiled-Coil Domain Containing 78 (CCDC78))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC78 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CCDC78 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CCDC78 antibody was raised against the middle region of CCDC78

Aufreinigung: Affinity purified

Immunogen: CCDC78 antibody was raised using the middle region of CCDC78 corresponding to a region with amino acids QELRHKAQVPGHSDDHRFQVQPKNTMDPENEQHRLGSGVSVQPPSSGERA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CCDC78 Blocking Peptide, (ABIN5612717), is also available for use as a blocking control in assays to test for specificity of this CCDC78 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC78 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCDC78

Target: CCDC78 (Coiled-Coil Domain Containing 78 (CCDC78))

Andere Bezeichnung: CCDC78

Hintergrund: The function of CCDC78 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development