CCDC78 Antikörper (Middle Region)
Kurzübersicht für CCDC78 Antikörper (Middle Region) (ABIN632324)
Target
Alle CCDC78 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- Middle Region
-
Spezifität
- CCDC78 antibody was raised against the middle region of CCDC78
-
Aufreinigung
- Affinity purified
-
Immunogen
- CCDC78 antibody was raised using the middle region of CCDC78 corresponding to a region with amino acids QELRHKAQVPGHSDDHRFQVQPKNTMDPENEQHRLGSGVSVQPPSSGERA
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
CCDC78 Blocking Peptide, (ABIN5612717), is also available for use as a blocking control in assays to test for specificity of this CCDC78 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC78 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- CCDC78 (Coiled-Coil Domain Containing 78 (CCDC78))
-
Andere Bezeichnung
- CCDC78
-
Hintergrund
- The function of CCDC78 protein has not been widely studied, and is yet to be fully elucidated.
-
Molekulargewicht
- 37 kDa (MW of target protein)
-
Pathways
- Skeletal Muscle Fiber Development
Target
-