PPP1R11 Antikörper

Produktnummer ABIN632318

Produktdetails anti-PPP1R11 Antikörper

Target: PPP1R11 (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 11 (PPP1R11))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP1R11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PPP1 R11 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP1R11 Blocking Peptide, catalog no. 33R-5629, is also available for use as a blocking control in assays to test for specificity of this PPP1R11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP1R11

Target: PPP1R11 (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 11 (PPP1R11))

Andere Bezeichnung: PPP1R11 (PPP1R11 Produkte)

Synonyme: HCG-V antikoerper, HCGV antikoerper, IPP3 antikoerper, TCTE5 antikoerper, TCTEX5 antikoerper, 1500041B02Rik antikoerper, AV117883 antikoerper, Hcgv antikoerper, Tcte5 antikoerper, Tctex-5 antikoerper, Tctex5 antikoerper, wu:fj64e04 antikoerper, zgc:110245 antikoerper, protein phosphatase 1 regulatory inhibitor subunit 11 antikoerper, protein phosphatase 1, regulatory (inhibitor) subunit 11 antikoerper, PPP1R11 antikoerper, Ppp1r11 antikoerper, ppp1r11 antikoerper

Hintergrund: This gene encodes a specific inhibitor of protein phosphatase-1 (PP1) with a differential sensitivity toward the metal-independent and metal-dependent forms of PP1.

Molekulargewicht: 14 kDa (MW of target protein)