PPP1R11 Antikörper

Produktnummer ABIN632318

Der Kaninchen-Polyklonal Anti-PPP1R11-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von PPP1R11 in Proben aus Human und Ratte. }

Kurzübersicht für PPP1R11 Antikörper (ABIN632318)

Target: PPP1R11 (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 11 (PPP1R11))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP1R11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PPP1R11 Antikörper

Aufreinigung: Affinity purified

Immunogen: PPP1 R11 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP1R11 Blocking Peptide, (ABIN5615507), is also available for use as a blocking control in assays to test for specificity of this PPP1R11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP1R11

Target: PPP1R11 (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 11 (PPP1R11))

Andere Bezeichnung: PPP1R11

Hintergrund: This gene encodes a specific inhibitor of protein phosphatase-1 (PP1) with a differential sensitivity toward the metal-independent and metal-dependent forms of PP1.

Molekulargewicht: 14 kDa (MW of target protein)