SAMD4A Antikörper (Middle Region)
-
- Target Alle SAMD4A Antikörper anzeigen
- SAMD4A (Sterile alpha Motif Domain Containing 4A (SAMD4A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SAMD4A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SAMD4 A antibody was raised against the middle region of SAMD4
- Aufreinigung
- Affinity purified
- Immunogen
- SAMD4 A antibody was raised using the middle region of SAMD4 corresponding to a region with amino acids LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK
- Top Product
- Discover our top product SAMD4A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SAMD4A Blocking Peptide, catalog no. 33R-5106, is also available for use as a blocking control in assays to test for specificity of this SAMD4A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMD0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SAMD4A (Sterile alpha Motif Domain Containing 4A (SAMD4A))
- Andere Bezeichnung
- SAMD4A (SAMD4A Produkte)
- Hintergrund
- Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein.
- Molekulargewicht
- 79 kDa (MW of target protein)
-