SAMD4A Antikörper (Middle Region)

Produktnummer ABIN632312

Produktdetails anti-SAMD4A Antikörper

Target: SAMD4A (Sterile alpha Motif Domain Containing 4A (SAMD4A))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SAMD4A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SAMD4 A antibody was raised against the middle region of SAMD4

Aufreinigung: Affinity purified

Immunogen: SAMD4 A antibody was raised using the middle region of SAMD4 corresponding to a region with amino acids LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SAMD4A Blocking Peptide, catalog no. 33R-5106, is also available for use as a blocking control in assays to test for specificity of this SAMD4A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMD0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SAMD4A

Target: SAMD4A (Sterile alpha Motif Domain Containing 4A (SAMD4A))

Andere Bezeichnung: SAMD4A (SAMD4A Produkte)

Hintergrund: Sterile alpha motifs (SAMs) in proteins such as SAMD4A are part of an RNA-binding domain that functions as a posttranscriptional regulator by binding to an RNA sequence motif known as the Smaug recognition element, which was named after the Drosophila Smaug protein.

Molekulargewicht: 79 kDa (MW of target protein)