KLHDC2 Antikörper (N-Term)

Produktnummer ABIN632311

Produktdetails anti-KLHDC2 Antikörper

Target: KLHDC2 (Kelch Domain Containing 2 (KLHDC2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KLHDC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KLHDC2 antibody was raised against the N terminal of KLHDC2

Aufreinigung: Affinity purified

Immunogen: KLHDC2 antibody was raised using the N terminal of KLHDC2 corresponding to a region with amino acids VSDGRHMFVWGGYKSNQVRGLYDFYLPREELWIYNMETGRWKKINTEGDV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLHDC2 Blocking Peptide, catalog no. 33R-9800, is also available for use as a blocking control in assays to test for specificity of this KLHDC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KLHDC2

Target: KLHDC2 (Kelch Domain Containing 2 (KLHDC2))

Andere Bezeichnung: KLHDC2 (KLHDC2 Produkte)

Synonyme: MGC82652 antikoerper, HCLP-1 antikoerper, HCLP1 antikoerper, LCP antikoerper, 2310022K15Rik antikoerper, D12Ertd522e antikoerper, kelch domain containing 2 L homeolog antikoerper, kelch domain containing 2 antikoerper, klhdc2.L antikoerper, KLHDC2 antikoerper, Klhdc2 antikoerper

Hintergrund: KLHDC2 represses CREB3-mediated transcription by interfering with CREB3-DNA binding. It contains 6 Kelch repeats.

Molekulargewicht: 46 kDa (MW of target protein)