Cyclin J Antikörper (N-Term)

Produktnummer ABIN632310

Dieses Anti-Cyclin J-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Cyclin J in WB. Geeignet für Human.

Kurzübersicht für Cyclin J Antikörper (N-Term) (ABIN632310)

Target: Cyclin J (CCNJ)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cyclin J Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Cyclin J Antikörper

Bindungsspezifität: N-Term

Spezifität: Cyclin J antibody was raised against the N terminal of CCNJ

Aufreinigung: Affinity purified

Immunogen: Cyclin J antibody was raised using the N terminal of CCNJ corresponding to a region with amino acids FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cyclin J Blocking Peptide, (ABIN938382), is also available for use as a blocking control in assays to test for specificity of this Cyclin J antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNJ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cyclin J

Target: Cyclin J (CCNJ)

Andere Bezeichnung: Cyclin J

Hintergrund: Cyclin J may be involved in cell division and differentiation.

Molekulargewicht: 42 kDa (MW of target protein)