Syntrophin gamma 1 Antikörper (Middle Region)

Produktnummer ABIN632306

Produktdetails anti-Syntrophin gamma 1 Antikörper

Target: Syntrophin gamma 1 (SNTG1) (Syntrophin, gamma 1 (SNTG1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Syntrophin gamma 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Syntrophin Gamma 1 antibody was raised against the middle region of SNTG1

Aufreinigung: Affinity purified

Immunogen: Syntrophin Gamma 1 antibody was raised using the middle region of SNTG1 corresponding to a region with amino acids RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Syntrophin Gamma 1 Blocking Peptide, catalog no. 33R-7908, is also available for use as a blocking control in assays to test for specificity of this Syntrophin Gamma 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNTG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Syntrophin gamma 1

Target: Syntrophin gamma 1 (SNTG1) (Syntrophin, gamma 1 (SNTG1))

Andere Bezeichnung: Syntrophin gamma 1 (SNTG1 Produkte)

Synonyme: SNTG1 antikoerper, G1SYN antikoerper, SYN4 antikoerper, 4933426D16Rik antikoerper, RGD1560290 antikoerper, syntrophin gamma 1 antikoerper, gamma-1-syntrophin antikoerper, syntrophin, gamma 1 antikoerper, SNTG1 antikoerper, sntg1 antikoerper, LOC100548083 antikoerper, Sntg1 antikoerper

Hintergrund: The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins.

Molekulargewicht: 58 kDa (MW of target protein)