SUN3 Antikörper (C-Term)
-
- Target Alle SUN3 Antikörper anzeigen
- SUN3 (Sad1 and UNC84 Domain Containing 3 (SUN3))
- Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SUN3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SUNC1 antibody was raised against the C terminal of SUNC1
- Aufreinigung
- Affinity purified
- Immunogen
- SUNC1 antibody was raised using the C terminal of SUNC1 corresponding to a region with amino acids IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SUNC1 Blocking Peptide, catalog no. 33R-4024, is also available for use as a blocking control in assays to test for specificity of this SUNC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUNC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SUN3 (Sad1 and UNC84 Domain Containing 3 (SUN3))
- Andere Bezeichnung
- SUNC1 (SUN3 Produkte)
- Hintergrund
- SUNC1 is a single-pass membrane protein. It contains 1 Unc84 (SUN) domain.
- Molekulargewicht
- 40 kDa (MW of target protein)
-