XAF1 Antikörper (Middle Region)

Produktnummer ABIN632298

Der Kaninchen Polyklonal anti-XAF1 Antikörper (ABIN632298) detektiert spezifisch XAF1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für XAF1 Antikörper (Middle Region) (ABIN632298)

Target: XAF1 (XiAP Associated Factor 1 (XAF1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser XAF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-XAF1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: XAF1 antibody was raised against the middle region of XAF1

Aufreinigung: Affinity purified

Immunogen: XAF1 antibody was raised using the middle region of XAF1 corresponding to a region with amino acids SRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

XAF1 Blocking Peptide, (ABIN5617035), is also available for use as a blocking control in assays to test for specificity of this XAF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XAF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu XAF1

Target: XAF1 (XiAP Associated Factor 1 (XAF1))

Andere Bezeichnung: XAF1

Hintergrund: X-linked inhibitor of apoptosis is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases.

Molekulargewicht: 34 kDa (MW of target protein)