C11orf53 Antikörper (Middle Region)

Produktnummer ABIN632297

Der Kaninchen Polyklonal anti-C11orf53 Antikörper wird verwendet zum Nachweis von C11orf53 in Proben von Human und Ratte. Er wurde validiert für WB.

Kurzübersicht für C11orf53 Antikörper (Middle Region) (ABIN632297)

Target: C11orf53 (Chromosome 11 Open Reading Frame 53 (C11orf53))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C11orf53 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C11orf53 Antikörper

Bindungsspezifität: Middle Region

Spezifität: C11 ORF53 antibody was raised against the middle region of C11 rf53

Aufreinigung: Affinity purified

Immunogen: C11 ORF53 antibody was raised using the middle region of C11 rf53 corresponding to a region with amino acids SIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C11ORF53 Blocking Peptide, (ABIN5612390), is also available for use as a blocking control in assays to test for specificity of this C11ORF53 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF53 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C11orf53

Target: C11orf53 (Chromosome 11 Open Reading Frame 53 (C11orf53))

Andere Bezeichnung: C11ORF53

Hintergrund: The function of Chromosome 11 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 25 kDa (MW of target protein)