Proline Rich 13 Antikörper (N-Term)

Produktnummer ABIN632293

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Proline Rich 13 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für Proline Rich 13 Antikörper (N-Term) (ABIN632293)

Target: Proline Rich 13 (PRR13)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Proline Rich 13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Proline Rich 13 Antikörper

Bindungsspezifität: N-Term

Spezifität: PRR13 antibody was raised against the N terminal of PRR13

Aufreinigung: Affinity purified

Immunogen: PRR13 antibody was raised using the N terminal of PRR13 corresponding to a region with amino acids MWNPNAGQPGPNPYPPNIGCPGGSNPAHPPPINPPFPPGPCPPPPGAPHG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRR13 Blocking Peptide, (ABIN5615590), is also available for use as a blocking control in assays to test for specificity of this PRR13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Proline Rich 13

Target: Proline Rich 13 (PRR13)

Andere Bezeichnung: PRR13

Hintergrund: PRR13 negatively regulates TSP1 expression at the level of transcription. This down-regulation was shown to reduce taxane-induced apoptosis.

Molekulargewicht: 15 kDa (MW of target protein)