ARL11 Antikörper (Middle Region)

Produktnummer ABIN632291

Produktdetails anti-ARL11 Antikörper

Target: ARL11 (ADP-Ribosylation Factor-Like 11 (ARL11))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ARL11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ARL11 antibody was raised against the middle region of ARL11

Aufreinigung: Affinity purified

Immunogen: ARL11 antibody was raised using the middle region of ARL11 corresponding to a region with amino acids WKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARL11 Blocking Peptide, catalog no. 33R-9959, is also available for use as a blocking control in assays to test for specificity of this ARL11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ARL11

Target: ARL11 (ADP-Ribosylation Factor-Like 11 (ARL11))

Andere Bezeichnung: ARL11 (ARL11 Produkte)

Synonyme: zgc:56090 antikoerper, wu:fc38d01 antikoerper, arl11 antikoerper, MGC89886 antikoerper, ARL11 antikoerper, MGC154392 antikoerper, ARLTS1 antikoerper, C730007L20Rik antikoerper, ADP-ribosylation factor-like 11 antikoerper, ADP ribosylation factor like GTPase 11 antikoerper, ADP-ribosylation factor like GTPase 11 antikoerper, arl11 antikoerper, ARL11 antikoerper, Arl11 antikoerper

Hintergrund: ARL11 belongs to the small GTPase superfamily, Arf family. It may play a role in apoptosis and act as a tumor suppressor. Defects in ARL11 may be a cause of susceptibility to chronic lymphocytic leukemia (CLL).

Molekulargewicht: 21 kDa (MW of target protein)