GORASP1 Antikörper (N-Term)

Produktnummer ABIN632290

Produktdetails anti-GORASP1 Antikörper

Target: GORASP1 (Golgi Reassembly Stacking Protein 1, 65kDa (GORASP1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GORASP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GORASP1 antibody was raised against the N terminal of GORASP1

Aufreinigung: Affinity purified

Immunogen: GORASP1 antibody was raised using the N terminal of GORASP1 corresponding to a region with amino acids PYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GORASP1 Blocking Peptide, catalog no. 33R-7444, is also available for use as a blocking control in assays to test for specificity of this GORASP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GORASP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GORASP1

Target: GORASP1 (Golgi Reassembly Stacking Protein 1, 65kDa (GORASP1))

Andere Bezeichnung: GORASP1 (GORASP1 Produkte)

Synonyme: MGC69226 antikoerper, MGC134531 antikoerper, 5430411C10Rik antikoerper, GOLPH5 antikoerper, GRASP65 antikoerper, P65 antikoerper, cb744 antikoerper, zgc:101588 antikoerper, golgi reassembly stacking protein 1 antikoerper, golgi perepheral membrane protein p65 antikoerper, golgi reassembly stacking protein 1a antikoerper, GORASP1 antikoerper, gorasp1 antikoerper, PTRG_03298 antikoerper, PY00200 antikoerper, Gorasp1 antikoerper, gorasp1a antikoerper

Hintergrund: The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a caspase-3 substrate, and cleavage of this encoded protein contributes to Golgi fragmentation in apoptosis. This encoded protein can form a complex with the Golgi matrix protein GOLGA2, and this complex binds to the vesicle docking protein p115. Several alternatively spliced transcript variants of this gene have been identified, but their full-length natures have not been determined.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom