THYN1 Antikörper (Middle Region)

Produktnummer ABIN632288

Der Kaninchen Polyklonal anti-THYN1 Antikörper wird verwendet zum Nachweis von THYN1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für THYN1 Antikörper (Middle Region) (ABIN632288)

Target: THYN1 (Thymocyte Nuclear Protein 1 (THYN1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser THYN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-THYN1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: THYN1 antibody was raised against the middle region of THYN1

Aufreinigung: Affinity purified

Immunogen: THYN1 antibody was raised using the middle region of THYN1 corresponding to a region with amino acids NPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

THYN1 Blocking Peptide, (ABIN5616597), is also available for use as a blocking control in assays to test for specificity of this THYN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THYN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu THYN1

Target: THYN1 (Thymocyte Nuclear Protein 1 (THYN1))

Andere Bezeichnung: THYN1

Hintergrund: THYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis.

Molekulargewicht: 26 kDa (MW of target protein)