C1orf92 Antikörper (Middle Region)

Produktnummer ABIN632284

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch C1orf92 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für C1orf92 Antikörper (Middle Region) (ABIN632284)

Target: C1orf92 (LRRC71) (Leucine Rich Repeat Containing 71 (LRRC71))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C1orf92 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C1orf92 Antikörper

Bindungsspezifität: Middle Region

Spezifität: C1 ORF92 antibody was raised against the middle region of C1 rf92

Aufreinigung: Affinity purified

Immunogen: C1 ORF92 antibody was raised using the middle region of C1 rf92 corresponding to a region with amino acids VDKTDKTQTMKTPKGLGKKKEKSWELAKKEEKLGSGQSPTQGTPKKEDAT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF92 Blocking Peptide, (ABIN5612464), is also available for use as a blocking control in assays to test for specificity of this C1ORF92 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF92 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C1orf92

Target: C1orf92 (LRRC71) (Leucine Rich Repeat Containing 71 (LRRC71))

Andere Bezeichnung: C1ORF92

Hintergrund: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 39 kDa (MW of target protein)