C1orf92 Antikörper (Middle Region)

Produktnummer ABIN632284

Produktdetails anti-C1orf92 Antikörper

Target: C1orf92 (LRRC71) (Leucine Rich Repeat Containing 71 (LRRC71))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C1orf92 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C1 ORF92 antibody was raised against the middle region of C1 rf92

Aufreinigung: Affinity purified

Immunogen: C1 ORF92 antibody was raised using the middle region of C1 rf92 corresponding to a region with amino acids VDKTDKTQTMKTPKGLGKKKEKSWELAKKEEKLGSGQSPTQGTPKKEDAT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF92 Blocking Peptide, catalog no. 33R-9468, is also available for use as a blocking control in assays to test for specificity of this C1ORF92 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF92 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C1orf92

Target: C1orf92 (LRRC71) (Leucine Rich Repeat Containing 71 (LRRC71))

Andere Bezeichnung: C1ORF92 (LRRC71 Produkte)

Synonyme: C1orf92 antikoerper, RP11-356J7.1 antikoerper, 4933430H15Rik antikoerper, cilia and flagella associated protein 46 antikoerper, leucine rich repeat containing 71 antikoerper, cfap46 antikoerper, LRRC71 antikoerper, Lrrc71 antikoerper

Hintergrund: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 39 kDa (MW of target protein)