ADHFE1 Antikörper (Middle Region)

Produktnummer ABIN632283

Dieser Anti-ADHFE1-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von ADHFE1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für ADHFE1 Antikörper (Middle Region) (ABIN632283)

Target: ADHFE1 (Alcohol Dehydrogenase, Iron Containing, 1 (ADHFE1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADHFE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ADHFE1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ADHFE1 antibody was raised against the middle region of ADHFE1

Aufreinigung: Affinity purified

Immunogen: ADHFE1 antibody was raised using the middle region of ADHFE1 corresponding to a region with amino acids RIVAKYLKRAVRNPDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPIS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADHFE1 Blocking Peptide, (ABIN5611952), is also available for use as a blocking control in assays to test for specificity of this ADHFE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADHFE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADHFE1

Target: ADHFE1 (Alcohol Dehydrogenase, Iron Containing, 1 (ADHFE1))

Andere Bezeichnung: ADHFE1

Hintergrund: ADHFE1 is hydroxyacid-oxoacid transhydrogenase, which is responsible for the oxidation of 4-hydroxybutyrate in mammalian tissues.

Molekulargewicht: 50 kDa (MW of target protein)