IDI1 Antikörper (Middle Region)

Produktnummer ABIN632278

Produktdetails anti-IDI1 Antikörper

Target: IDI1 (Isopentenyl-Diphosphate delta Isomerase 1 (IDI1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IDI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IDI1 antibody was raised against the middle region of IDI1

Aufreinigung: Affinity purified

Immunogen: IDI1 antibody was raised using the middle region of IDI1 corresponding to a region with amino acids PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IDI1 Blocking Peptide, catalog no. 33R-7208, is also available for use as a blocking control in assays to test for specificity of this IDI1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDI1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IDI1

Target: IDI1 (Isopentenyl-Diphosphate delta Isomerase 1 (IDI1))

Andere Bezeichnung: IDI1 (IDI1 Produkte)

Synonyme: zgc:114138 antikoerper, 4832416K17Rik antikoerper, ipp1 antikoerper, ippl1 antikoerper, IPP1 antikoerper, IPPI1 antikoerper, isopentenyl-diphosphate delta isomerase 1 antikoerper, isopentenyl-diphosphate delta isomerase antikoerper, isopentenyl-diphosphate delta isomerase 1 L homeolog antikoerper, idi1 antikoerper, Idi1 antikoerper, idi1.L antikoerper, IDI1 antikoerper

Hintergrund: IDI1 is a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity.

Molekulargewicht: 32 kDa (MW of target protein)