Allantoicase Antikörper (N-Term)

Produktnummer ABIN632271

Produktdetails anti-Allantoicase Antikörper

Target: Allantoicase (ALLC)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Allantoicase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ALLC antibody was raised against the N terminal of ALLC

Aufreinigung: Affinity purified

Immunogen: ALLC antibody was raised using the N terminal of ALLC corresponding to a region with amino acids VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALLC Blocking Peptide, catalog no. 33R-9608, is also available for use as a blocking control in assays to test for specificity of this ALLC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALLC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Allantoicase

Target: Allantoicase (ALLC)

Andere Bezeichnung: ALLC (ALLC Produkte)

Synonyme: PSPTO3668 antikoerper, ALC antikoerper, 1700012B22Rik antikoerper, Alc antikoerper, zgc:91799 antikoerper, allantoicase antikoerper, allantoicase L homeolog antikoerper, allc antikoerper, ALLC antikoerper, PSPTO_3668 antikoerper, BPSL2945 antikoerper, BPSL2116 antikoerper, CND02340 antikoerper, allC antikoerper, Gbro_4026 antikoerper, BC1002_2649 antikoerper, Tbis_2589 antikoerper, Arnit_1068 antikoerper, Srot_2184 antikoerper, Ndas_0715 antikoerper, Psed_1757 antikoerper, Sinme_4918 antikoerper, Allc antikoerper, allc.L antikoerper

Hintergrund: Allantoicase participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase, was lost during vertebrate evolution.

Molekulargewicht: 43 kDa (MW of target protein)