Allantoicase Antikörper (N-Term)

Produktnummer ABIN632271

Dieses Anti-Allantoicase-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Allantoicase in WB. Geeignet für Human.

Kurzübersicht für Allantoicase Antikörper (N-Term) (ABIN632271)

Target: Allantoicase (ALLC)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Allantoicase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Allantoicase Antikörper

Bindungsspezifität: N-Term

Spezifität: ALLC antibody was raised against the N terminal of ALLC

Aufreinigung: Affinity purified

Immunogen: ALLC antibody was raised using the N terminal of ALLC corresponding to a region with amino acids VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALLC Blocking Peptide, (ABIN5612027), is also available for use as a blocking control in assays to test for specificity of this ALLC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALLC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Allantoicase

Target: Allantoicase (ALLC)

Andere Bezeichnung: ALLC

Hintergrund: Allantoicase participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase, was lost during vertebrate evolution.

Molekulargewicht: 43 kDa (MW of target protein)