CAB39 Antikörper (Middle Region)

Produktnummer ABIN632269

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CAB39 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für CAB39 Antikörper (Middle Region) (ABIN632269)

Target: CAB39 (Calcium Binding Protein 39 (CAB39))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CAB39 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CAB39 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CAB39 antibody was raised against the middle region of CAB39

Aufreinigung: Affinity purified

Immunogen: CAB39 antibody was raised using the middle region of CAB39 corresponding to a region with amino acids KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CAB39 Blocking Peptide, catalog no. 33R-4688, is also available for use as a blocking control in assays to test for specificity of this CAB39 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAB39 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CAB39

Target: CAB39 (Calcium Binding Protein 39 (CAB39))

Andere Bezeichnung: CAB39

Hintergrund: Together with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, CAB39 forms a regulatory complex capable of stimulating the activity of STK11.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: AMPK Signaling