FUNDC1 Antikörper (N-Term)

Produktnummer ABIN632253

Dieses Anti-FUNDC1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von FUNDC1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für FUNDC1 Antikörper (N-Term) (ABIN632253)

Target: FUNDC1 (FUN14 Domain Containing 1 (FUNDC1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FUNDC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FUNDC1 Antikörper

Bindungsspezifität: N-Term

Spezifität: FUNDC1 antibody was raised against the N terminal of FUNDC1

Aufreinigung: Affinity purified

Immunogen: FUNDC1 antibody was raised using the N terminal of FUNDC1 corresponding to a region with amino acids MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FUNDC1 Blocking Peptide, catalog no. 33R-5789, is also available for use as a blocking control in assays to test for specificity of this FUNDC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUNDC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FUNDC1

Target: FUNDC1 (FUN14 Domain Containing 1 (FUNDC1))

Andere Bezeichnung: FUNDC1

Hintergrund: FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.

Molekulargewicht: 17 kDa (MW of target protein)