WDR66 Antikörper (N-Term)

Produktnummer ABIN632250

Dieses Anti-WDR66-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von WDR66 in WB. Geeignet für Human.

Kurzübersicht für WDR66 Antikörper (N-Term) (ABIN632250)

Target: WDR66 (WD Repeat Domain 66 (WDR66))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WDR66 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-WDR66 Antikörper

Bindungsspezifität: N-Term

Spezifität: WDR66 antibody was raised against the N terminal of WDR66

Aufreinigung: Affinity purified

Immunogen: WDR66 antibody was raised using the N terminal of WDR66 corresponding to a region with amino acids GELEEKTDRMPQDELGQERRDLEPENREEGQERRVSDIQSKAGISRESLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WDR66 Blocking Peptide, (ABIN938620), is also available for use as a blocking control in assays to test for specificity of this WDR66 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR66 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WDR66

Target: WDR66 (WD Repeat Domain 66 (WDR66))

Andere Bezeichnung: WDR66

Hintergrund: WDR66 contains 9 WD repeats. The functions of WDR66 remain unknown.

Molekulargewicht: 130 kDa (MW of target protein)