TRIB1 Antikörper

Produktnummer ABIN632249

Produktdetails anti-TRIB1 Antikörper

Target: TRIB1 (Tribbles Homolog 1 (TRIB1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRIB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: TRIB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRIB1 Blocking Peptide, catalog no. 33R-9035, is also available for use as a blocking control in assays to test for specificity of this TRIB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRIB1

Target: TRIB1 (Tribbles Homolog 1 (TRIB1))

Andere Bezeichnung: TRIB1 (TRIB1 Produkte)

Synonyme: TRIB1 antikoerper, c8fw antikoerper, gig2 antikoerper, skip1 antikoerper, trb1 antikoerper, tribbles antikoerper, C8FW antikoerper, GIG2 antikoerper, SKIP1 antikoerper, TRB1 antikoerper, A530090O15Rik antikoerper, TRB-1 antikoerper, Trb1 antikoerper, Gig2 antikoerper, tribbles pseudokinase 1 antikoerper, tribbles pseudokinase 1 L homeolog antikoerper, tribbles homolog 1 (Drosophila) antikoerper, TRIB1 antikoerper, trib1 antikoerper, trib1.L antikoerper, Trib1 antikoerper

Hintergrund: TRIB1 interacts with MAPK kinases and regulates activation of MAP kinases. TRIB1 may not display kinase activity.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: Smooth Muscle Cell Migration