BCKDK Antikörper (N-Term)

Produktnummer ABIN632248

Produktdetails anti-BCKDK Antikörper

Target: BCKDK (Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BCKDK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BCKDK antibody was raised against the N terminal of BCKDK

Aufreinigung: Affinity purified

Immunogen: BCKDK antibody was raised using the N terminal of BCKDK corresponding to a region with amino acids CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BCKDK Blocking Peptide, catalog no. 33R-1742, is also available for use as a blocking control in assays to test for specificity of this BCKDK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCKDK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BCKDK

Target: BCKDK (Branched Chain Ketoacid Dehydrogenase Kinase (BCKDK))

Andere Bezeichnung: BCKDK (BCKDK Produkte)

Hintergrund: BCkDaK belongs to the PDK/BCkDaK protein kinase family. It contains 1 histidine kinase domain. BCkDaK catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex, the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. BCkDaK is the key enzyme that regulates the activity state of the BCkDa complex.

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom