TBCB Antikörper (C-Term)

Produktnummer ABIN632246

Produktdetails anti-TBCB Antikörper

Target: TBCB (Tubulin Folding Cofactor B (TBCB))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TBCB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TBCB antibody was raised against the C terminal of TBCB

Aufreinigung: Affinity purified

Immunogen: TBCB antibody was raised using the C terminal of TBCB corresponding to a region with amino acids YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBCB Blocking Peptide, catalog no. 33R-10065, is also available for use as a blocking control in assays to test for specificity of this TBCB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBCB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TBCB

Target: TBCB (Tubulin Folding Cofactor B (TBCB))

Andere Bezeichnung: TBCB (TBCB Produkte)

Synonyme: CG22 antikoerper, CKAP1 antikoerper, CKAPI antikoerper, 2410007D12Rik antikoerper, AU041393 antikoerper, Ckap1 antikoerper, ZH14 antikoerper, ckap1 antikoerper, ik:tdsubc_2e4 antikoerper, wu:fa56d03 antikoerper, xx:tdsubc_2e4 antikoerper, zgc:55620 antikoerper, TBCB antikoerper, cg22 antikoerper, ckapi antikoerper, CG11242 antikoerper, Dmel\CG11242 antikoerper, dTBCB antikoerper, tubulin folding cofactor B antikoerper, tubulin folding cofactor B S homeolog antikoerper, tubulin-folding cofactor B antikoerper, tubulin-binding cofactor B antikoerper, TBCB antikoerper, Tbcb antikoerper, tbcb antikoerper, tbcb.S antikoerper, EMB2804 antikoerper, LOC9320850 antikoerper

Hintergrund: TBCB binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. It is involved in regulation of tubulin heterodimer dissociation. TBCB may function as a negative regulator of axonal growth.

Molekulargewicht: 27 kDa (MW of target protein)