TBCB Antikörper (C-Term)

Produktnummer ABIN632246

Der Kaninchen Polyklonal Anti-TBCB-Antikörper wurde für WB validiert. Er ist geeignet, TBCB in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für TBCB Antikörper (C-Term) (ABIN632246)

Target: TBCB (Tubulin Folding Cofactor B (TBCB))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TBCB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TBCB Antikörper

Bindungsspezifität: C-Term

Spezifität: TBCB antibody was raised against the C terminal of TBCB

Aufreinigung: Affinity purified

Immunogen: TBCB antibody was raised using the C terminal of TBCB corresponding to a region with amino acids YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TBCB Blocking Peptide, (ABIN936023), is also available for use as a blocking control in assays to test for specificity of this TBCB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBCB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TBCB

Target: TBCB (Tubulin Folding Cofactor B (TBCB))

Andere Bezeichnung: TBCB

Hintergrund: TBCB binds to alpha-tubulin folding intermediates after their interaction with cytosolic chaperonin in the pathway leading from newly synthesized tubulin to properly folded heterodimer. It is involved in regulation of tubulin heterodimer dissociation. TBCB may function as a negative regulator of axonal growth.

Molekulargewicht: 27 kDa (MW of target protein)