CK1 alpha 1 (C-Term) Antikörper

Produktnummer ABIN632245

Produktdetails

Target: CK1 alpha 1

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Western Blotting (WB)

Spezifität: CK1 alpha 1 antibody was raised against the C terminal of CSNK1 A1

Aufreinigung: Affinity purified

Immunogen: CK1 alpha 1 antibody was raised using the C terminal of CSNK1 A1 corresponding to a region with amino acids HQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CK1 alpha 1 Blocking Peptide, catalog no. 33R-3833, is also available for use as a blocking control in assays to test for specificity of this CK1 alpha 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: CK1 alpha 1

Hintergrund: CSNK1A1 belongs to the protein kinase superfamily. The function of the CSNK1A1 protein is not known.

Molekulargewicht: 37 kDa (MW of target protein)