IL-33 Antikörper (N-Term)
-
- Target Alle IL-33 (IL33) Antikörper anzeigen
- IL-33 (IL33) (Interleukin 33 (IL33))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IL-33 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IL33 antibody was raised against the N terminal of IL33
- Aufreinigung
- Affinity purified
- Immunogen
- IL33 antibody was raised using the N terminal of IL33 corresponding to a region with amino acids AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC
- Top Product
- Discover our top product IL33 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IL33 Blocking Peptide, catalog no. 33R-1291, is also available for use as a blocking control in assays to test for specificity of this IL33 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL33 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL-33 (IL33) (Interleukin 33 (IL33))
- Andere Bezeichnung
- IL33 (IL33 Produkte)
- Hintergrund
- Cytokine that binds to and signals through IL1RL1/ST2 and its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. IL33 induces T helper type 2-associated cytokines.
- Molekulargewicht
- 31 kDa (MW of target protein)
- Pathways
- Production of Molecular Mediator of Immune Response
-