IL-33 Antikörper (N-Term)

Produktnummer ABIN632244

Dieses Anti-IL-33-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von IL-33 in WB. Geeignet für Human.

Kurzübersicht für IL-33 Antikörper (N-Term) (ABIN632244)

Target: IL-33 (IL33) (Interleukin 33 (IL33))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL-33 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IL-33 Antikörper

Bindungsspezifität: N-Term

Spezifität: IL33 antibody was raised against the N terminal of IL33

Aufreinigung: Affinity purified

Immunogen: IL33 antibody was raised using the N terminal of IL33 corresponding to a region with amino acids AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL33 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this IL33 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL33 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IL-33

Target: IL-33 (IL33) (Interleukin 33 (IL33))

Andere Bezeichnung: IL33

Hintergrund: Cytokine that binds to and signals through IL1RL1/ST2 and its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. IL33 induces T helper type 2-associated cytokines.

Molekulargewicht: 31 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response