FAM53C Antikörper (N-Term)

Produktnummer ABIN632235

Dieses Anti-FAM53C-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von FAM53C in WB. Geeignet für Human.

Kurzübersicht für FAM53C Antikörper (N-Term) (ABIN632235)

Target: FAM53C (Family with Sequence Similarity 53, Member C (FAM53C))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM53C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FAM53C Antikörper

Bindungsspezifität: N-Term

Spezifität: FAM53 C antibody was raised against the N terminal of FAM53

Aufreinigung: Affinity purified

Immunogen: FAM53 C antibody was raised using the N terminal of FAM53 corresponding to a region with amino acids SNCGNSFQLVSEGASWRGLPHCSCAEFQDSLNFSYHPSGLSLHLRPPSRG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM53C Blocking Peptide, (ABIN5613490), is also available for use as a blocking control in assays to test for specificity of this FAM53C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM50 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM53C

Target: FAM53C (Family with Sequence Similarity 53, Member C (FAM53C))

Andere Bezeichnung: FAM53C

Hintergrund: The function of FAM53 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 43 kDa (MW of target protein)