IFI44 Antikörper (Middle Region)

Produktnummer ABIN632234

Produktdetails anti-IFI44 Antikörper

Target: IFI44 (Interferon-Induced Protein 44 (IFI44))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IFI44 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IFI44 antibody was raised against the middle region of IFI44

Aufreinigung: Affinity purified

Immunogen: IFI44 antibody was raised using the middle region of IFI44 corresponding to a region with amino acids LIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IFI44 Blocking Peptide, catalog no. 33R-5042, is also available for use as a blocking control in assays to test for specificity of this IFI44 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFI44 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IFI44

Target: IFI44 (Interferon-Induced Protein 44 (IFI44))

Andere Bezeichnung: IFI44 (IFI44 Produkte)

Synonyme: MATP44 antikoerper, MTAP44 antikoerper, TLDC5 antikoerper, p44 antikoerper, A430056A10Rik antikoerper, AW261460 antikoerper, interferon induced protein 44 antikoerper, interferon-induced protein 44 antikoerper, IFI44 antikoerper, Ifi44 antikoerper

Hintergrund: This protein aggregates to form microtubular structures.

Molekulargewicht: 50 kDa (MW of target protein)