IFI44 Antikörper (Middle Region)

Produktnummer ABIN632234

Der Kaninchen Polyklonal Anti-IFI44-Antikörper wurde für WB validiert. Er ist geeignet, IFI44 in Proben von Human zu detektieren.

Kurzübersicht für IFI44 Antikörper (Middle Region) (ABIN632234)

Target: IFI44 (Interferon-Induced Protein 44 (IFI44))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IFI44 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IFI44 Antikörper

Bindungsspezifität: Middle Region

Spezifität: IFI44 antibody was raised against the middle region of IFI44

Aufreinigung: Affinity purified

Immunogen: IFI44 antibody was raised using the middle region of IFI44 corresponding to a region with amino acids LIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IFI44 Blocking Peptide, (ABIN940428), is also available for use as a blocking control in assays to test for specificity of this IFI44 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFI44 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IFI44

Target: IFI44 (Interferon-Induced Protein 44 (IFI44))

Andere Bezeichnung: IFI44

Hintergrund: This protein aggregates to form microtubular structures.

Molekulargewicht: 50 kDa (MW of target protein)