INSL5 Antikörper (Middle Region)

Produktnummer ABIN632233

Produktdetails anti-INSL5 Antikörper

Target: INSL5 (Insulin-Like 5 (INSL5))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser INSL5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: INSL5 antibody was raised against the middle region of INSL5

Aufreinigung: Affinity purified

Immunogen: INSL5 antibody was raised using the middle region of INSL5 corresponding to a region with amino acids RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

INSL5 Blocking Peptide, catalog no. 33R-8237, is also available for use as a blocking control in assays to test for specificity of this INSL5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSL5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu INSL5

Target: INSL5 (Insulin-Like 5 (INSL5))

Andere Bezeichnung: INSL5 (INSL5 Produkte)

Synonyme: PRO182 antikoerper, UNQ156 antikoerper, RIF2 antikoerper, insulin like 5 antikoerper, insulin-like 5 antikoerper, INSL5 antikoerper, Insl5 antikoerper

Hintergrund: The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7).

Molekulargewicht: 13 kDa (MW of target protein)

Pathways: Hormone Activity