INSL5 Antikörper (Middle Region)
-
- Target Alle INSL5 Antikörper anzeigen
- INSL5 (Insulin-Like 5 (INSL5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser INSL5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- INSL5 antibody was raised against the middle region of INSL5
- Aufreinigung
- Affinity purified
- Immunogen
- INSL5 antibody was raised using the middle region of INSL5 corresponding to a region with amino acids RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK
- Top Product
- Discover our top product INSL5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
INSL5 Blocking Peptide, catalog no. 33R-8237, is also available for use as a blocking control in assays to test for specificity of this INSL5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSL5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- INSL5 (Insulin-Like 5 (INSL5))
- Andere Bezeichnung
- INSL5 (INSL5 Produkte)
- Synonyme
- PRO182 antikoerper, UNQ156 antikoerper, RIF2 antikoerper, insulin like 5 antikoerper, insulin-like 5 antikoerper, INSL5 antikoerper, Insl5 antikoerper
- Hintergrund
- The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7).
- Molekulargewicht
- 13 kDa (MW of target protein)
- Pathways
- Hormone Activity
-