GK2 Antikörper (C-Term)

Produktnummer ABIN632225

Produktdetails anti-GK2 Antikörper

Target: GK2 (Glycerol Kinase 2 (GK2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GK2 antibody was raised against the C terminal of GK2

Aufreinigung: Affinity purified

Immunogen: GK2 antibody was raised using the C terminal of GK2 corresponding to a region with amino acids QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GK2 Blocking Peptide, catalog no. 33R-7592, is also available for use as a blocking control in assays to test for specificity of this GK2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GK2

Target: GK2 (Glycerol Kinase 2 (GK2))

Andere Bezeichnung: GK2 (GK2 Produkte)

Synonyme: GKP2 antikoerper, GKTA antikoerper, Gk-rs2 antikoerper, N(alpha)-acetyltransferase 11, NatA catalytic subunit antikoerper, glycerol kinase 2 antikoerper, glycerol kinase antikoerper, NAA11 antikoerper, GK2 antikoerper, PPA_RS11645 antikoerper, ATEG_05802 antikoerper, AGROH133_15068 antikoerper, Gk2 antikoerper

Hintergrund: GK2 belongs to the FGGY kinase family. GK2 is a key enzyme in the regulation of glycerol uptake and metabolism.

Molekulargewicht: 61 kDa (MW of target protein)