GK2 Antikörper (C-Term)

Produktnummer ABIN632225

Der Kaninchen Polyklonal anti-GK2 Antikörper wird verwendet zum Nachweis von GK2 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für GK2 Antikörper (C-Term) (ABIN632225)

Target: GK2 (Glycerol Kinase 2 (GK2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GK2 Antikörper

Bindungsspezifität: C-Term

Spezifität: GK2 antibody was raised against the C terminal of GK2

Aufreinigung: Affinity purified

Immunogen: GK2 antibody was raised using the C terminal of GK2 corresponding to a region with amino acids QIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GK2 Blocking Peptide, (ABIN5613777), is also available for use as a blocking control in assays to test for specificity of this GK2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GK2

Target: GK2 (Glycerol Kinase 2 (GK2))

Andere Bezeichnung: GK2

Hintergrund: GK2 belongs to the FGGY kinase family. GK2 is a key enzyme in the regulation of glycerol uptake and metabolism.

Molekulargewicht: 61 kDa (MW of target protein)