CSNK2A1/CK II alpha Antikörper (C-Term)

Produktnummer ABIN632224

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CSNK2A1/CK II alpha in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für CSNK2A1/CK II alpha Antikörper (C-Term) (ABIN632224)

Target: CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CSNK2A1/CK II alpha Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CSNK2A1/CK II alpha Antikörper

Bindungsspezifität: C-Term

Spezifität: CK2 alpha antibody was raised against the C terminal of CSNK2 A2

Aufreinigung: Affinity purified

Immunogen: CK2 alpha antibody was raised using the C terminal of CSNK2 A2 corresponding to a region with amino acids GTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CK2 alpha Blocking Peptide, (ABIN938991), is also available for use as a blocking control in assays to test for specificity of this CK2 alpha antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CSNK2A1/CK II alpha

Target: CSNK2A1/CK II alpha (CSNK2A1) (Casein Kinase 2 alpha 1 (CSNK2A1))

Andere Bezeichnung: CK2 alpha

Hintergrund: CSNK2A2 belongs to the protein kinase superfamily, Ser/Thr protein kinase family, CK2 subfamily. It contains 1 protein kinase domain. Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. The alpha and alpha' chains contain the catalytic site. CSNK2A2 participates in Wnt signaling. It phosphorylates 'Ser-392' of p53/TP53 following UV irradiation.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom