Glutaredoxin 1 Antikörper
-
- Target Alle Glutaredoxin 1 (GRX1) Antikörper anzeigen
- Glutaredoxin 1 (GRX1)
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Glutaredoxin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GLRX antibody was raised using a synthetic peptide corresponding to a region with amino acids IKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLV
- Top Product
- Discover our top product GRX1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GLRX Blocking Peptide, catalog no. 33R-4029, is also available for use as a blocking control in assays to test for specificity of this GLRX antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Glutaredoxin 1 (GRX1)
- Andere Bezeichnung
- GLRX (GRX1 Produkte)
- Synonyme
- Glrx1 antikoerper, Grx antikoerper, grx antikoerper, wu:fc38f02 antikoerper, zgc:103707 antikoerper, GLRXL antikoerper, Grx1 antikoerper, TTase antikoerper, C86710 antikoerper, D13Wsu156e antikoerper, grx1 antikoerper, GLRX antikoerper, GRX antikoerper, GRX1 antikoerper, GLRX1 antikoerper, TTF antikoerper, glrx antikoerper, glutaredoxin antikoerper, glutaredoxin (thioltransferase) antikoerper, glutaredoxin Grx1 antikoerper, NrdH-redoxin antikoerper, Uncharacterized monothiol glutaredoxin F10D7.3 antikoerper, glutaredoxin-1 (Grx1) antikoerper, temporal expression: late antikoerper, glutaredoxin L homeolog antikoerper, Glrx antikoerper, glrx antikoerper, GLRX antikoerper, grx1 antikoerper, AF_RS07750 antikoerper, F10D7.3 antikoerper, AFUA_1G06100 antikoerper, NT01EI_2528 antikoerper, O2L antikoerper, glrx.L antikoerper
- Substanzklasse
- Viral Protein
- Hintergrund
- GLRX has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. It reduces low molecular weight disulfides and proteins.
- Molekulargewicht
- 12 kDa (MW of target protein)
- Pathways
- Cell RedoxHomeostasis
-