Glutaredoxin 1 Antikörper

Produktnummer ABIN632220

Produktdetails anti-Glutaredoxin 1 Antikörper

Target: Glutaredoxin 1 (GRX1)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Glutaredoxin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GLRX antibody was raised using a synthetic peptide corresponding to a region with amino acids IKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLRX Blocking Peptide, catalog no. 33R-4029, is also available for use as a blocking control in assays to test for specificity of this GLRX antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Glutaredoxin 1

Target: Glutaredoxin 1 (GRX1)

Andere Bezeichnung: GLRX (GRX1 Produkte)

Substanzklasse: Viral Protein

Hintergrund: GLRX has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. It reduces low molecular weight disulfides and proteins.

Molekulargewicht: 12 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis