HORMAD2 Antikörper (N-Term)

Produktnummer ABIN632218

Produktdetails anti-HORMAD2 Antikörper

Target: HORMAD2 (HORMA Domain Containing 2 (HORMAD2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HORMAD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HORMAD2 antibody was raised against the N terminal of HORMAD2

Aufreinigung: Affinity purified

Immunogen: HORMAD2 antibody was raised using the N terminal of HORMAD2 corresponding to a region with amino acids VKKLFATSISCITYLRGLFPESSYGERHLDDLSLKILREDKKCPGSLHII

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HORMAD2 Blocking Peptide, catalog no. 33R-9626, is also available for use as a blocking control in assays to test for specificity of this HORMAD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HORMAD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HORMAD2

Target: HORMAD2 (HORMA Domain Containing 2 (HORMAD2))

Andere Bezeichnung: HORMAD2 (HORMAD2 Produkte)

Synonyme: 4930529M09Rik antikoerper, HORMA domain containing 2 antikoerper, HORMAD2 antikoerper, Hormad2 antikoerper

Hintergrund: The function of HORMAD protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 35 kDa (MW of target protein)