Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

HORMAD2 Antikörper (N-Term)

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch HORMAD2 in WB. Er zeigt eine Reaktivität gegenüber Human.
Produktnummer ABIN632218

Kurzübersicht für HORMAD2 Antikörper (N-Term) (ABIN632218)

Target

Alle HORMAD2 Antikörper anzeigen
HORMAD2 (HORMA Domain Containing 2 (HORMAD2))

Reaktivität

  • 16
  • 5
  • 4
  • 3
  • 3
  • 3
  • 2
  • 2
  • 2
  • 1
  • 1
Human

Wirt

  • 14
  • 2
Kaninchen

Klonalität

  • 15
  • 1
Polyklonal

Konjugat

  • 12
  • 2
  • 1
  • 1
Dieser HORMAD2 Antikörper ist unkonjugiert

Applikation

  • 9
  • 8
  • 3
Western Blotting (WB)
  • Bindungsspezifität

    • 5
    • 2
    • 1
    • 1
    • 1
    N-Term

    Spezifität

    HORMAD2 antibody was raised against the N terminal of HORMAD2

    Aufreinigung

    Affinity purified

    Immunogen

    HORMAD2 antibody was raised using the N terminal of HORMAD2 corresponding to a region with amino acids VKKLFATSISCITYLRGLFPESSYGERHLDDLSLKILREDKKCPGSLHII
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    HORMAD2 Blocking Peptide, (ABIN5614059), is also available for use as a blocking control in assays to test for specificity of this HORMAD2 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HORMAD2 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    HORMAD2 (HORMA Domain Containing 2 (HORMAD2))

    Andere Bezeichnung

    HORMAD2

    Hintergrund

    The function of HORMAD protein is not widely studied, and is yet to be elucidated fully.

    Molekulargewicht

    35 kDa (MW of target protein)
Sie sind hier:
Chat with us!